Mazdutide

Mazdutide Overview: A Dual Agonist for Weight Loss and Diabetes

Mazdutide is a GLP-1R/GCGR dual agonist developed for managing obesity and type 2 diabetes (T2D). This Mazdutide peptide targets both glucagon-like peptide-1 (GLP-1) and glucagon receptors, promoting weight loss, improving blood glucose control, and offering cardiometabolic benefits. Research shows Mazdutide can reduce body weight by up to 15.4% in overweight or obese individuals and lower HbA1c levels in T2D patients, making it a promising candidate in anti-obesity therapy and diabetes management.

Mazdutide Structure: Molecular Details and Sequence

Understanding the structure of Mazdutide is essential for researchers exploring GLP-1R/GCGR dual agonists and their applications in obesity treatment and diabetes therapy. Below are the key structural details of this Mazdutide peptide:

• Sequence: Not publicly disclosed; Mazdutide is a synthetic analog of oxyntomodulin (HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA) with proprietary modifications.
• Molecular Formula: C207H317N45O65
• Molecular Weight: 4563.07 g/mol
• PubChem CID: 167312357
• CAS Number: 2259884-03-0

As a synthetic analog of oxyntomodulin, the Mazdutide structure enables dual activation of GLP-1 and glucagon receptors, making it a powerful tool in weight loss research and metabolic health studies.

What is Mazdutide? A Next-Generation GLP-1R/GCGR Dual Agonist

Mazdutide (also known as IBI362 or LY3305677) is a synthetic peptide and a GLP-1R/GCGR dual agonist designed to target both glucagon-like peptide-1 (GLP-1) and glucagon receptors. This Mazdutide peptide promotes weight loss by increasing energy expenditure and reducing appetite, while also improving blood glucose levels in T2D patients. It offers additional cardiometabolic benefits, such as lowering blood pressure, lipids, and liver fat, positioning it as a leading candidate in anti-obesity therapy and diabetes management.

Mazdutide Research: Exploring Benefits and Applications

1. Mazdutide in Obesity Management

Mazdutide for obesity has shown significant efficacy in clinical trials. In a Phase 3 trial (GLORY-1), Chinese adults with overweight or obesity achieved up to 13.38% body weight reduction after 48 weeks with 6 mg Mazdutide, alongside improvements in cardiometabolic health markers like blood pressure, lipids, and liver fat content.

2. Mazdutide in Type 2 Diabetes

Mazdutide for type 2 diabetes demonstrated superior glycemic control in the Phase 3 DREAMS-2 trial, with HbA1c reductions of up to 1.73% after 28 weeks compared to 1.36% with dulaglutide. It also supported weight loss, with 64.3% of patients on 6 mg achieving at least 5% body weight reduction, enhancing its role in diabetes management.

3. Mazdutide and Cardiometabolic Benefits

Research on Mazdutide and cardiometabolic health highlights its ability to improve multiple risk factors. Phase 1 and 2 trials showed reductions in systolic blood pressure, triglycerides, cholesterol, and liver fat, making it a promising therapy for metabolic syndrome and related conditions.

4. Mazdutide in Non-Alcoholic Fatty Liver Disease (NAFLD)

Mazdutide for NAFLD has shown potential in reducing liver fat content. In the GLORY-1 trial, patients experienced up to 13.6% liver fat reduction with 6 mg Mazdutide, suggesting benefits for hepatic health in obese individuals.

5. Mazdutide Safety and Tolerability

Mazdutide safety studies indicate it is well-tolerated, with the most common side effects being gastrointestinal (e.g., nausea, diarrhea). Phase 2 trials reported mild to moderate adverse events, with low discontinuation rates, supporting its use in anti-obesity therapy and diabetes treatment.

Reference

1. A phase 2 randomised controlled trial of mazdutide in Chinese overweight adults or adults with obesity by L. Ji et al., Nature Communications, vol. 14, no. 8289, Dec. 2023.
2. Efficacy and Safety of Mazdutide in Chinese Patients With Type 2 Diabetes: A Randomized, Double-Blind, Placebo-Controlled Phase 2 Trial by B. Zhang et al., Diabetes Care, vol. 47, no. 1, pp. 160–168, Jan. 2024.
3. Efficacy and safety of Mazdutide on weight loss among diabetic and non-diabetic patients: a systematic review and meta-analysis of randomized controlled trials by D. L. Nalisa et al., Front Endocrinol (Lausanne), vol. 15, no. 1309118, Feb. 2024.
4. Safety and efficacy of a GLP-1 and glucagon receptor dual agonist mazdutide (IBI362) 9 mg and 10 mg in Chinese adults with overweight or obesity: A randomised, placebo-controlled, multiple-ascending-dose phase 1b trial by L. Ji et al., EClinicalMedicine, vol. 54, no. 101691, Oct. 2022.
5. EASD 2024: Innovent shows off mazdutide’s efficacy in diabetes and obesity by Clinical Trials Arena, Sep. 2024.